Claudin-19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159277

Catalog No. NBP159277

Description

Claudin-19 Polyclonal specifically detects Claudin-19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Claudin-19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: claudin 19, claudin-19
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 149461
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N6F1
• Gene Symbols: CLDN19
• Immunogen: Synthetic peptides corresponding to CLDN19(claudin 19) The peptide sequence was selected from the C terminal of CLDN19. Peptide sequence AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Pig: 100%; Rabbit: 100%; Equine: 92%; Bovine: 85%; Guinea pig: 85%; Mouse: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only