Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31748125UL
Description
CLCA4 Polyclonal antibody specifically detects CLCA4 in Human samples. It is validated for ImmunofluorescenceSpecifications
| CLCA4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| caCC-2, CaCC2CaCC, Calcium-activated chloride channel family member 4, Calcium-activated chloride channel protein 2, calcium-activated chloride channel regulator 4, chloride channel accessory 4, chloride channel regulator 4, chloride channel, calcium activated, family member 4, hCaCC-2, hCLCA4, MGC142247, MGC142249 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQT | |
| 25 μg | |
| Endocrinology, Signal Transduction | |
| 22802 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction