Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CLCC1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
CLCC1 Polyclonal specifically detects CLCC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CLCC1 | |
Polyclonal | |
Purified | |
RUO | |
chloride channel CLIC-like 1, KIAA0761, MCLCchloride channel CLIC-like protein 1, Mid1-related chloride channel, Mid-1-related chloride channel 1, Mid-1-related chloride channel protein 1 | |
CLCC1 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Q96S66 | |
23155 | |
Synthetic peptides corresponding to CLCC1(chloride channel CLIC-like 1) The peptide sequence was selected from the N terminal of CLCC1. Peptide sequence MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title