CLCN5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169123

Catalog No. NBP169123

Description

CLCN5 Polyclonal specifically detects CLCN5 in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CLCN5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CLCN5
• Immunogen: Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1184
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, clC-5, CLC5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.