Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCN5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CLCN5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1692320
|
Novus Biologicals
NBP16912320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169123
|
Novus Biologicals
NBP169123 |
100 μL |
Each for $487.50
|
|
|||||
Description
CLCN5 Polyclonal specifically detects CLCN5 in Mouse, Rat samples. It is validated for Western Blot.Specifications
| CLCN5 | |
| Polyclonal | |
| Rabbit | |
| chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, clC-5, CLC5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN | |
| CLCN5 | |
| IgG | |
| 83 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 1184 | |
| Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title