Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cleavage stimulation factor Antibody, Novus Biologicals™
SDP

Catalog No. NBP233486 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233486 0.1 mL
NB397410 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP233486 Supplier Novus Biologicals Supplier No. NBP233486
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

cleavage stimulation factor Polyclonal specifically detects cleavage stimulation factor in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen cleavage stimulation factor
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q05048
Gene Alias CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit, cleavage stimulation factor subunit 1, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD, cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa, CSTF 50 kDa subunit, CstF-50, CstFp50
Gene Symbols CSTF1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 1477
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.