Invitrogen™ CLEC9A Polyclonal Antibody

Catalog No.	Quantity
PIPA595594	100 μg

Catalog No. PIPA595594 Supplier Invitrogen™ Supplier No. PA595594

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - Flow: Jurkat cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

C-type lectin domain family 9 member A (CLEC9A) is a gene located on chromosome 12p13.2, encoding a protein that belongs to the C-type lectin receptor family. CLEC9A is primarily expressed on dendritic cells and certain subsets of macrophages, playing a pivotal role in the immune system by recognizing and binding dead cell debris, including necrotic cells. This receptor facilitates the presentation of antigens derived from dead cells to T cells, thus contributing to the initiation of immune responses. CLEC9A is involved in cross-presentation, a process crucial for adaptive immunity, particularly in the context of viral infections and cancer. Its expression and activity are of particular interest for vaccine development and immunotherapy, given its ability to enhance antigen presentation and stimulate robust immune responses. Research into CLEC9A continues to explore its therapeutic potential for modulating immune activity in various diseases, including cancer and infectious diseases.

Specifications

• Antigen: CLEC9A
• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunocytochemistry
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: CLEC9A
• Gene Accession No.: Q6UXN8
• Gene Alias: 9830005G06Rik; CD370; Clec9a; C-type lectin domain family 9 member A; C-type lectin domain family 9, member A; Dendritic cell natural killer lectin group receptor 1; DNGR1; DNGR-1; HEEE9341; RGD1562513; UNQ9341; UNQ9341/PRO34046
• Gene Symbols: CLEC9A
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).
• Purification Method: Affinity Chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 283420
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG