CLECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154397

Catalog No. NBP154397

Description

CLECL1 Polyclonal specifically detects CLECL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CLECL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C-type lectin-like 1, C-type lectin-like domain family 1, DCAL-1, DCAL1dendritic cell associated lectin 1, DC-associated lectin-1, Dendritic cell-associated lectin 1, dendritic cell-associated lectin-1, type II transmembrane protein DCAL1
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IZS7
• Gene Symbols: CLECL1
• Immunogen: Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 160365
• Target Species: Human
• Isotype: IgG