Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15439720UL
Description
CLECL1 Polyclonal specifically detects CLECL1 in Human samples. It is validated for Western Blot.Specifications
CLECL1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8IZS7 | |
CLECL1 | |
Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK. | |
Affinity Purified | |
RUO | |
160365 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C-type lectin-like 1, C-type lectin-like domain family 1, DCAL-1, DCAL1dendritic cell associated lectin 1, DC-associated lectin-1, Dendritic cell-associated lectin 1, dendritic cell-associated lectin-1, type II transmembrane protein DCAL1 | |
Rabbit | |
19 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction