Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLECL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | CLECL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15439720
![]() |
Novus Biologicals
NBP15439720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP154397
![]() |
Novus Biologicals
NBP154397 |
100 μL |
Each for $487.50
|
|
|||||
Description
CLECL1 Polyclonal specifically detects CLECL1 in Human samples. It is validated for Western Blot.Specifications
CLECL1 | |
Polyclonal | |
Rabbit | |
Human | |
C-type lectin-like 1, C-type lectin-like domain family 1, DCAL-1, DCAL1dendritic cell associated lectin 1, DC-associated lectin-1, Dendritic cell-associated lectin 1, dendritic cell-associated lectin-1, type II transmembrane protein DCAL1 | |
CLECL1 | |
IgG | |
19 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8IZS7 | |
160365 | |
Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title