Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLN6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	CLN6
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15964620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15964620UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159646 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159646	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CLN6 Polyclonal specifically detects CLN6 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CLN6
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9NWW5
Gene ID (Entrez)	54982
Immunogen	Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the middle region of CLN6. Peptide sequence LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ceroid-lipofuscinosis neuronal protein 6, ceroid-lipofuscinosis, neuronal 6, late infantile, variant, FLJ20561, HsT18960, nclf, Protein CLN6
Gene Symbols	CLN6
Isotype	IgG
Molecular Weight of Antigen	36 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CLN6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents