Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLNS1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233959
Description
CLNS1A Polyclonal specifically detects CLNS1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CLNS1A | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
P54105 | |
CLNS1A | |
This antibody was developed against a recombinant protein corresponding to amino acids: EDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQ | |
0.1 mL | |
DNA replication Transcription Translation and Splicing | |
1207 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
chloride channel regulatory protein, Chloride channel, nucleotide sensitive 1A, chloride channel, nucleotide-sensitive, 1A, Chloride conductance regulatory protein ICln, Chloride ion current inducer protein, ClCI, CLNS1B, I(Cln), ICln, methylosome subunit pICln, Reticulocyte pICln, reticulocyte protein ICln | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction