CLOCK Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-933-977	100 μL

Catalog No. 89-933-977 Supplier Abnova Corporation Supplier No. PAB29318

Description

Rabbit polyclonal antibody raised against recombinant human CLOCK.

This gene encodes a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1. [provided by RefSeq]

Sequence: RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS

Specifications

• Antigen: CLOCK
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant human CLOCK.
• Dilution: Immunohistochemistry (1:20-1:50) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: KAT13D/KIAA0334/bHLHe8
• Gene Symbols: CLOCK
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CLOCK.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9575
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG