Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLP24/TMEM204 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP188444
Description
CLP24/TMEM204 Polyclonal specifically detects CLP24/TMEM204 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CLP24/TMEM204 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
C16orf30chromosome 16 open reading frame 30, Claudin-like protein 24, CLP24MGC111564, FLJ20898, transmembrane protein 204 | |
Rabbit | |
Affinity Purified | |
RUO | |
79652 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TMEM204 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction