CLRN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170501

Catalog No. NBP170501

Description

CLRN1 Polyclonal specifically detects CLRN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CLRN1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C3orf76, CLRN1, family with sequence similarity 188, member B2, Putative UPF0526 protein B
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig 77%, Porcine 77%.
• Target Species: Human, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: FAM188B2
• Immunogen: Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 646951
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.