Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLRN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17050120UL
Description
CLRN1 Polyclonal specifically detects CLRN1 in Human samples. It is validated for Western Blot.Specifications
| CLRN1 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| C3orf76, CLRN1, family with sequence similarity 188, member B2, Putative UPF0526 protein B | |
| Rabbit | |
| 51 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FAM188B2 | |
| Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING. | |
| Affinity Purified | |
| RUO | |
| 646951 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction