Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89933978

CLTA Rabbit anti-Human, Polyclonal , Abnova™

Catalog No. 89933978 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-978 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-978 Supplier Abnova Corporation Supplier No. PAB29433
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant human CLTA.

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: NDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPE

Specifications

Antigen CLTA
Applications Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant human CLTA.
Dilution Immunohistochemistry (1:2500-1:5000) Immunofluorescence (1-4 ug/mL) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene Alias LCA
Gene Symbols CLTA
Host Species Rabbit
Immunogen Recombinant protein corresponding to human CLTA.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1211
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.