Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLVS2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

$173.10 - $403.50

Specifications

Antigen	CLVS2
Dilution	Western Blot 1:500-1:2000
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB417240 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP2923860.02ML	0.02 mL	Each for $173.10	Only null left	Sign In or Register to check your price. Add to Cart

NB417239 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP2923860.1ML	0.1 mL	Each for $403.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

CLVS2 Polyclonal antibody specifically detects CLVS2 in Human samples. It is validated for Western Blot

Specifications

Antigen	CLVS2
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Signal Transduction
Formulation	PBS with 50% glycerol, pH7.3.
Gene ID (Entrez)	134829
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500-1:2000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	bA160A10.4;C6orf212;C6orf213;Clavesin-2;RLBP1L2
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 265-327 of human CLVS2 (NP_001010852.2). LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CLVS2 Antibody - Azide and BSA Free, Novus Biologicals™

Specifications

Description

Specifications

Documents