Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CMAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CMAS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CMAS Polyclonal specifically detects CMAS in Human samples. It is validated for Western Blot.Specifications
CMAS | |
Polyclonal | |
Rabbit | |
Q8NFW8 | |
55907 | |
Synthetic peptides corresponding to CMAS(cytidine monophosphate N-acetylneuraminic acid synthetase) The peptide sequence was selected from the N terminal of CMAS. Peptide sequence GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CMP-N-acetylneuraminic acid synthase, CMP-N-acetylneuraminic acid synthetase, CMP-Neu5Ac synthetase, CMP-NeuNAc synthase, CMP-NeuNAc synthetase, cytidine 5'-monophosphate N-acetylneuraminic acid synthetase, cytidine monophosphate N-acetylneuraminic acid synthetase, EC 2.7.7.43, N-acylneuraminate cytidylyltransferase | |
CMAS | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title