CMTM4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184456

Catalog No. NBP184456

Description

CMTM4 Polyclonal specifically detects CMTM4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CMTM4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: chemokine-like factor super family 4, chemokine-like factor superfamily 4, Chemokine-like factor superfamily member 4, CKLF-like MARVEL transmembrane domain containing 4, CKLF-like MARVEL transmembrane domain-containing protein 4, CKLFSF4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CMTM4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL
• Quantity: 0.1 mL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 146223
• Target Species: Human
• Isotype: IgG

For Research Use Only