Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CNBP Antibody, Novus Biologicals™

CNBP Antibody, Novus Biologicals™
SDP

Catalog No. NB403898 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403898 25 μL
NBP255690 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403898 Supplier Novus Biologicals Supplier No. NBP25569025UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CNBP Polyclonal specifically detects CNBP in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CNBP
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
Gene Symbols CNBP
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 7555
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.