Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNIH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP184422
Description
CNIH Polyclonal specifically detects CNIH in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CNIH | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
CNIH1, CNILMGC117156, cornichon homolog (Drosophila), T-cell growth-associated molecule 77, TGAM77protein cornichon homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
10175 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CNIH1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction