Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CNNM4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CNNM4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159423
View Documents
Novus Biologicals
NBP159423
100 μL
Each for $436.00
Add to cart
 
NBP15942320
View Documents
Novus Biologicals
NBP15942320UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

CNNM4 Polyclonal specifically detects CNNM4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CNNM4
Polyclonal
Rabbit
Vision
Q6P4Q7
26504
Synthetic peptides corresponding to CNNM4(cyclin M4) The peptide sequence was selected from the middle region of CNNM4. Peptide sequence LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
ACDP4cyclin-M4, Ancient conserved domain-containing protein 4, cyclin M4, Cyclin-M4, FLJ37746, FLJ42791, KIAA1592ancient conserved domain protein 4, metal transporter CNNM4
CNNM4
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit