Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNNM4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CNNM4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159423
|
Novus Biologicals
NBP159423 |
100 μL |
Each for $436.00
|
|
NBP15942320
|
Novus Biologicals
NBP15942320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CNNM4 Polyclonal specifically detects CNNM4 in Human samples. It is validated for Western Blot.Specifications
| CNNM4 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| Q6P4Q7 | |
| 26504 | |
| Synthetic peptides corresponding to CNNM4(cyclin M4) The peptide sequence was selected from the middle region of CNNM4. Peptide sequence LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ACDP4cyclin-M4, Ancient conserved domain-containing protein 4, cyclin M4, Cyclin-M4, FLJ37746, FLJ42791, KIAA1592ancient conserved domain protein 4, metal transporter CNNM4 | |
| CNNM4 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title