CNPase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185997

Catalog No. NBP185997

Description

CNPase Polyclonal specifically detects CNPase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CNPase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CNP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
• Quantity: 0.1 mL
• Research Discipline: Cellular Markers, Glia Markers, Neuronal Cell Markers, Neuroscience, Oligodendrocyte Cell Markers
• Gene ID (Entrez): 1267
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.3mg/mL
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: 2', 3' cyclic nucleotide 3' phosphohydrolase, 2'-3'-cyclic nucleotide 3' phosphodiesterase, 2'-3'-cyclic-nucleotide 3'-phosphodiesterase, CNP1, CNPase, EC 3.1.4.37
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only