Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNTD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CNTD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CNTD Polyclonal specifically detects CNTD in Human samples. It is validated for Western Blot.Specifications
CNTD | |
Polyclonal | |
Rabbit | |
Q8N815 | |
124817 | |
Synthetic peptides corresponding to CNTD1 (cyclin N-terminal domain containing 1) The peptide sequence was selected from the N terminal of CNTD1. Peptide sequence QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CNTD, cyclin N-terminal domain containing, cyclin N-terminal domain containing 1, cyclin N-terminal domain-containing protein 1, FLJ40137 | |
CNTD1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title