Coagulation Factor II/Thrombin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP158268

Catalog No. NBP158268

Description

Coagulation Factor II/Thrombin Polyclonal specifically detects Coagulation Factor II/Thrombin in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Coagulation Factor II/Thrombin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Coagulation Factor II, coagulation factor II (thrombin) receptor-like 2, Coagulation factor II receptor-like 2, Coagulation factor II receptor-like 2 (protease-actovated receptor 3), PAR-3, PAR3proteinase-activated receptor 3, protease-activated receptor 3, proteinase-activated receptor-3, PT, serine protease, Thrombin receptor-like 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: P00734
• Gene Symbols: F2
• Immunogen: Synthetic peptides corresponding to F2(coagulation factor II (thrombin)) The peptide sequence was selected from the middle region of F2 (NP_000497). Peptide sequence ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2147
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Sheep, Zebrafish
• Isotype: IgG

For Research Use Only