Cochlin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169140

Catalog No. NBP169140

Description

Cochlin Polyclonal specifically detects Cochlin in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cochlin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coagulation factor C (Limulus polyphemus homolog); cochlin, coagulation factor C homolog, cochlin (Limulus polyphemus), COCH-5B2COCH5B2, cochlin, DFNA9
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43405
• Gene Symbols: COCH
• Immunogen: Synthetic peptides corresponding to COCH (coagulation factor C homolog, cochlin (Limulus polyphemus)) The peptide sequence was selected from the N terminal of COCH. Peptide sequence AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1690
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.