Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579037

Invitrogen™ Cofilin 2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579037
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579037 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579037 Supplier Invitrogen™ Supplier No. PA579037
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Raji whole cell lysates, human HUVEC whole cell lysates, human HepG2 whole cell lysates, human Hela whole cell lysates, rat skeletal muscle tissue lysates, rat RH35 whole cell lysates, rat liver tissue lysates, mouse skeletal muscle tissue lysates, mouse liver tissue lysates. ICC/IF: U2OS cells. Flow: Raji cells.

Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cofilin 2
Applications Flow Cytometry, Western Blot, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene CFL2
Gene Accession No. P45591, Q9Y281
Gene Alias CFL2; COF2; cofilin 2; cofilin 2 (muscle); cofilin 2, muscle; cofilin, muscle isoform; Cofilin-2; HGNC:1875; NEM7; nemaline myopathy type 7
Gene Symbols CFL2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1073, 12632, 366624
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.