COG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230718

Catalog No. NBP230718

Description

COG4 Polyclonal specifically detects COG4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: COG4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9H9E3
• Gene Symbols: COG4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILDLKFCMDGVQTALRSEDYEQAAAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLL
• Quantity: 0.1 mL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 25839
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only