Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COL1A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP324756
Description
COL1A2 Polyclonal antibody specifically detects COL1A2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
COL1A2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
alpha 2(I)-collagen, Alpha-2 type I collagen, collagen alpha-2(I) chain, collagen I, alpha-2 polypeptide, collagen of skin, tendon and bone, alpha-2 chain, collagen, type I, alpha 2, OI4, osteogenesis imperfecta type IV, type I procollagen | |
This antibody has been engineered to specifically recognize the recombinant protein COL1A2 using the following amino acid sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV | |
100 μL | |
Cell Biology, Cytoskeleton Markers, Signal Transduction, Stem Cells | |
1278 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction