Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COL4A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16893920UL
Description
COL4A3 Polyclonal specifically detects COL4A3 in Human samples. It is validated for Western Blot.Specifications
Tumstatin/COL4A3 | |
Polyclonal | |
Western Blot | |
E7ENN2 | |
COL4A3 | |
Synthetic peptides corresponding to COL4A3 (collagen, type IV, alpha 3 (Goodpasture antigen)) The peptide sequence was selected form the N terminal of COL4A3. Peptide sequence GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
collagen alpha-3(IV) chain, collagen IV, alpha-3 polypeptide, collagen, type IV, alpha 3 (Goodpasture antigen), Goodpasture antigen, tumstatin | |
Rabbit | |
Affinity Purified | |
RUO | |
1285 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction