Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16893920

COL4A3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16893920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16893920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16893920 Supplier Novus Biologicals Supplier No. NBP16893920UL

Description

Rabbit Polyclonal Antibody

COL4A3 Polyclonal specifically detects COL4A3 in Human samples. It is validated for Western Blot.

Specifications

Antigen Tumstatin/COL4A3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. E7ENN2
Gene Alias collagen alpha-3(IV) chain, collagen IV, alpha-3 polypeptide, collagen, type IV, alpha 3 (Goodpasture antigen), Goodpasture antigen, tumstatin
Gene Symbols COL4A3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to COL4A3 (collagen, type IV, alpha 3 (Goodpasture antigen)) The peptide sequence was selected form the N terminal of COL4A3. Peptide sequence GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1285
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.