Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Collagen XVII Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23868625UL
Description
Collagen XVII Polyclonal specifically detects Collagen XVII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Collagen XVII | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9UMD9 | |
COL17A1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
180 kDa bullous pemphigoid antigen 2, BA16H23.2, BP180alpha 1 type XVII collagen, BPAG2bA16H23.2 (collagen, type XVII, alpha 1 (BP180)), Bullous pemphigoid antigen 2, bullous pemphigoid antigen 2 (180kD), Collagen 17, collagen alpha-1(XVII) chain, collagen XVII, alpha-1 polypeptide, collagen, type XVII, alpha 1, Collagen-17, FLJ60881, KIAA0204, LAD-1 | |
Rabbit | |
Affinity Purified | |
RUO | |
1308 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction