Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Collagen XXI Antibody, Novus Biologicals™
SDP

Catalog No. NB405512 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405512 25 μL
NBP191015 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405512 Supplier Novus Biologicals Supplier No. NBP19101525UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Collagen XXI Polyclonal specifically detects Collagen XXI in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Collagen XXI
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Concentration 0.05mg/mL
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96P44
Gene Alias alpha 1 chain-like collagen, alpha 1 type XXI collagen, COL1AL, COLA1L, Collagen 21, collagen alpha-1(XXI) chain, collagen, type XXI, alpha 1, Collagen-21, dJ682J15.1, dJ708F5.1, DKFZp564B052, FLJ39125, FLJ44623, MGC26619
Gene Symbols COL21A1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cytoskeleton Markers, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 81578
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.