COMMD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179661

Catalog No. NBP179661

Description

COMMD8 Polyclonal specifically detects COMMD8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COMMD8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COMM domain containing 8, COMM domain-containing protein 8, FLJ20502
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Rat: 86%; Rabbit: 86%; Yeast: 83%; Mouse: 79%; Bovine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_060315
• Gene Symbols: COMMD8
• Immunogen: Synthetic peptide directed towards the middle region of human COMMD8The immunogen for this antibody is COMMD8. Peptide sequence IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54951
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.