Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COMMD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | COMMD8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1796620
![]() |
Novus Biologicals
NBP17966120UL |
20 μL |
Each for $158.00
|
|
|||||
NBP179661
![]() |
Novus Biologicals
NBP179661 |
100 μL |
Each for $487.50
|
|
|||||
Description
COMMD8 Polyclonal specifically detects COMMD8 in Human samples. It is validated for Western Blot.Specifications
COMMD8 | |
Polyclonal | |
Rabbit | |
NP_060315 | |
54951 | |
Synthetic peptide directed towards the middle region of human COMMD8The immunogen for this antibody is COMMD8. Peptide sequence IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
COMM domain containing 8, COMM domain-containing protein 8, FLJ20502 | |
COMMD8 | |
IgG | |
21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title