Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COMMD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | COMMD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179661
![]() |
Novus Biologicals
NBP179661 |
100 μL |
Each for $480.74
|
|
|||||
NBP1796620
![]() |
Novus Biologicals
NBP17966120UL |
20 μL | N/A | N/A | N/A | ||||
Description
COMMD8 Polyclonal specifically detects COMMD8 in Human samples. It is validated for Western Blot.Specifications
| COMMD8 | |
| Polyclonal | |
| Rabbit | |
| NP_060315 | |
| 54951 | |
| Synthetic peptide directed towards the middle region of human COMMD8The immunogen for this antibody is COMMD8. Peptide sequence IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| COMM domain containing 8, COMM domain-containing protein 8, FLJ20502 | |
| COMMD8 | |
| IgG | |
| 21 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title