Novus Biologicals™ Common gamma Chain/IL-2 R gamma Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Common gamma Chain/IL-2 R gamma. Source: E.coli Amino Acid Sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL The Common gamma Chain/IL-2 R gamma Recombinant Protein Antigen is derived from E. coli. The Common gamma Chain/IL-2 R gamma Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 3561
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Common gamma Chain/IL-2 R gamma Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: CD132, CD132 antigen, CIDX, combined immunodeficiency, X-linked, common cytokine receptor gamma chain, common gamma-chain, cytokine receptor common subunit gamma, gamma(c), IL-2 receptor subunit gamma, IL-2R subunit gamma, IL-2RG, IMD4, interleukin 2 rece
• Gene Symbol: IL2RG
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: Human

For Research Use Only.