Complement C4a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24678325UL

Catalog No. NB396325

Description

Complement C4a Polyclonal antibody specifically detects Complement C4a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Complement C4a
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P0C0L5
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4, complement component 4A (Rodgers blood group), RG
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
• Quantity: 25 μL
• Research Discipline: Immunology, Innate Immunity
• Gene ID (Entrez): 720
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG