Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Complement Component C5aR1 Antibody, Novus Biologicals™

Complement Component C5aR1 Antibody, Novus Biologicals™
SDP

Catalog No. NB236132 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB236132 25 μg
NB238293 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB236132 Supplier Novus Biologicals Supplier No. NBP32127425UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Complement Component C5aR1 Polyclonal antibody specifically detects Complement Component C5aR1 in Human samples. It is validated for Western Blot

Specifications

Antigen Complement Component C5aR1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias C5A, C5a anaphylatoxin chemotactic receptor, C5aR, C5a-R, C5ARC5a anaphylatoxin receptor, C5R1C5a ligand, CD88, CD88 antigen, complement component 5 receptor 1, complement component 5 receptor 1 (C5a ligand), complement component 5a receptor 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline GPCR, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 728
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.