Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Complement Factor MASP3/MASP1 Antibody, Novus Biologicals™
SDP

Catalog No. NB406573 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406573 25 μL
NBP185460 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406573 Supplier Novus Biologicals Supplier No. NBP18546025UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Complement Factor MASP3/MASP1 Polyclonal specifically detects Complement Factor MASP3/MASP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Complement Factor MASP3/MASP1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Complement factor MASP-3, Complement-activating component of Ra-reactive factor, CRARF1, CRARFMAP1, DKFZp686I01199, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.104, EC 3.4.21.42, FLJ26383, mannan-binding lectin serine peptidase 1 (C4/C2 activating component ofRa-reactive factor), mannan-binding lectin serine protease 1, mannan-binding lectin serine protease 1 (C4/C2 activating component ofRa-reactive factor), Mannose-binding lectin-associated serine protease 1, Mannose-binding protein-associated serine protease, MAp44, MASP, MASP-1, MASP3, MGC126283, MGC126284, PRSS5, Ra-reactive factor serine protease p100, RaRF, Serine protease 5
Gene Symbols MASP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5648
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.