Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 30/GJB6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Connexin 30/GJB6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15919320
|
Novus Biologicals
NBP15919320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159193
|
Novus Biologicals
NBP159193 |
100 μL |
Each for $487.50
|
|
|||||
Description
Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Human samples. It is validated for Western Blot.Specifications
| Connexin 30/GJB6 | |
| Polyclonal | |
| Rabbit | |
| O95452 | |
| 10804 | |
| Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3 | |
| GJB6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title