Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Connexin 45 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579311
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579311 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579311 Supplier Invitrogen™ Supplier No. PA579311
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue. IHC: human intestinal cancer tissue, rat skeletal muscle tissue, mouse cardiac muscle tissue, human placneta tissue.

Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell closely packed transmembrane channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. Connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43. Connexins have four transmembrane, three intracellular, and two extracellular regions. Different tissues express different connexins, though tissue specificities overlap, and a given tissue or cell can express several different connexins. Developmental regulation of at least some of the connexin genes has been found. Embryo implantation is regulated in part by temporally changing patterns of expression of connexins in the embryo and the maternal decidua.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Connexin 45
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene GJC1
Gene Accession No. A4GG66, P28229, P36383
Gene Alias C130009G16Rik; Cnx45; connexin 45; connexin-45; CTC-296K1.4; CX45; Cxn-45; Gap junction alpha-7 protein; gap junction channel protein connexin 45; gap junction gamma-1 protein; gap junction membrane channel protein alpha 7; gap junction protein gamma 1; gap junction protein, gamma 1; gap junction protein, gamma 1, 45kDa; Gja7; Gja-7; GJC1
Gene Symbols GJC1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10052, 14615, 266706
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.