Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Connexin 45 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579311

Catalog No. PIPA579311


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue. IHC: human intestinal cancer tissue, rat skeletal muscle tissue, mouse cardiac muscle tissue, human placneta tissue.

Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell closely packed transmembrane channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. Connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43. Connexins have four transmembrane, three intracellular, and two extracellular regions. Different tissues express different connexins, though tissue specificities overlap, and a given tissue or cell can express several different connexins. Developmental regulation of at least some of the connexin genes has been found. Embryo implantation is regulated in part by temporally changing patterns of expression of connexins in the embryo and the maternal decidua.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Connexin 45
Polyclonal
Unconjugated
GJC1
C130009G16Rik; Cnx45; connexin 45; connexin-45; CTC-296K1.4; CX45; Cxn-45; Gap junction alpha-7 protein; gap junction channel protein connexin 45; gap junction gamma-1 protein; gap junction membrane channel protein alpha 7; gap junction protein gamma 1; gap junction protein, gamma 1; gap junction protein, gamma 1, 45kDa; Gja7; Gja-7; GJC1
Rabbit
Antigen affinity chromatography
RUO
10052, 14615, 266706
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 4mg trehalose and 0.05mg sodium azide
A4GG66, P28229, P36383
GJC1
A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
Safety and Handling

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.