Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 58/GJA9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Connexin 58/GJA9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159196
|
Novus Biologicals
NBP159196 |
100 μL |
Each for $436.00
|
|
NBP15919620
|
Novus Biologicals
NBP15919620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Connexin 58/GJA9 Polyclonal specifically detects Connexin 58/GJA9 in Human samples. It is validated for Western Blot.Specifications
| Connexin 58/GJA9 | |
| Polyclonal | |
| Rabbit | |
| P57773 | |
| 81025 | |
| Synthetic peptides corresponding to GJA9(gap junction protein, alpha 9, 59kDa) The peptide sequence was selected from the middle region of GJA9. Peptide sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| connexin 59, connexin-58, Connexin-59, CX58, Cx59, CX59gap junction alpha 10, Gap junction alpha-10 protein, gap junction alpha-9 protein, gap junction protein, alpha 10, 59kDa, gap junction protein, alpha 9, 59kDa, GJA10, MGC50985 | |
| GJA9 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title