Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Connexin 58/GJA9 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen Connexin 58/GJA9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159196
SDP
View Documents
Novus Biologicals
NBP159196
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

Connexin 58/GJA9 Polyclonal specifically detects Connexin 58/GJA9 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Connexin 58/GJA9
Polyclonal
Rabbit
P57773
81025
Synthetic peptides corresponding to GJA9(gap junction protein, alpha 9, 59kDa) The peptide sequence was selected from the middle region of GJA9. Peptide sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK.
Primary
Western Blot
Unconjugated
RUO
connexin 59, connexin-58, Connexin-59, CX58, Cx59, CX59gap junction alpha 10, Gap junction alpha-10 protein, gap junction alpha-9 protein, gap junction protein, alpha 10, 59kDa, gap junction protein, alpha 9, 59kDa, GJA10, MGC50985
GJA9
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.