Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | COP9 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
COP9 Polyclonal specifically detects COP9 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
COP9 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Neuronal Cell Markers, Neurotransmission, Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8533 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAM | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis), COP9 signalosome complex subunit 3, CSN3COP9 complex subunit 3, JAB1-containing signalosome subunit 3, SGN3COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 3, Signalosome subunit 3 | |
COPS3 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title