Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COP9 signalosome complex subunit 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	COP9 signalosome complex subunit 2
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP258587 View Documents View Product Certificates	Novus Biologicals NBP258587	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393377 View Documents View Product Certificates	Novus Biologicals NBP25858725UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

COP9 signalosome complex subunit 2 Polyclonal specifically detects COP9 signalosome complex subunit 2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	COP9 signalosome complex subunit 2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, Neuronal Cell Markers, Neurotransmission, Signal Transduction
Gene Alias	ALIEN, Alien homolog, COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), COP9 signalosome complex subunit 2, CSN2JAB1-containing signalosome subunit 2, SGN2TR-interacting protein 15, Signalosome subunit 2, thyroid receptor interacting protein 15, Thyroid receptor-interacting protein 15, TRIP15TRIP-15
Gene Symbols	COPS2
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	9318
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

COP9 signalosome complex subunit 2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents