COPB1 Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-933-985	100 μL

Catalog No. 89-933-985 Supplier Abnova Corporation Supplier No. PAB29484

Description

COPB1 polyclonal antibody raised against recombinant human COPB1.

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq]

Sequence: NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT

Specifications

• Antigen: COPB1
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: COPB1 polyclonal antibody raised against recombinant human COPB1.
• Dilution: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: COPB/DKFZp761K102/FLJ10341
• Gene Symbols: COPB1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human COPB1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1315
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG