COPB1 Rabbit anti-Human, Polyclonal , Abnova™

COPB1 polyclonal antibody raised against recombinant human COPB1.

Supplier:  Abnova Corporation PAB29484

Catalog No. 89-933-985

Description

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq]

Sequence: NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT

Specifications

• Antigen: COPB1
• Classification: Polyclonal
• Description: COPB1 polyclonal antibody raised against recombinant human COPB1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Symbols: COPB1
• Immunogen: Recombinant protein corresponding to amino acids of human COPB1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene Alias: COPB/DKFZp761K102/FLJ10341
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 1315
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG