COQ3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431157	Novus Biologicals NBP18872525UL	25 μL
NBP188725	Novus Biologicals NBP188725	0.1 mL

Description

COQ3 Polyclonal specifically detects COQ3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: COQ3
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 3-demethylubiquinone-10 3-methyltransferase, bA9819.1, coenzyme Q3 homolog, methyltransferase (S. cerevisiae), coenzyme Q3 homolog, methyltransferase (yeast), DHHB methyltransferase, DHHBMT, DHHB-MT, DHHB-MTase, DHHBMTASE, Dihydroxyhexaprenylbenzoate methyltransferase, EC 2.1.1, EC 2.1.1.114, EC 2.1.1.64, hexaprenyldihydroxybenzoate methyltransferase, mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase, methyltransferase COQ3, UG0215E05
• Gene Symbols: COQ3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51805
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KWWDEQGVYAPLHSMNDLRVPFIRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGASVIGIDPV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only