CORO2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181583

Catalog No. NBP181583

Description

CORO2A Polyclonal specifically detects CORO2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CORO2A
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CLIPINB, coronin, actin binding protein, 2A, coronin, actin-binding protein, 2A, coronin-like protein B, DKFZp686G19226, IR10coronin 2A, WD protein IR10, WD repeat-containing protein 2, WDR2coronin-2A, WD-repeat protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CORO2A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGW
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 7464
• Target Species: Human
• Isotype: IgG

For Research Use Only