Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COUP-TF I/NR2F1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | COUP-TF I/NR2F1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
COUP-TF I/NR2F1 Polyclonal specifically detects COUP-TF I/NR2F1 in Human samples. It is validated for Western Blot.Specifications
| COUP-TF I/NR2F1 | |
| Polyclonal | |
| Rabbit | |
| P10589 | |
| 7025 | |
| Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| COUP transcription factor 1, COUP-TF1, COUP-TFI, EAR-3COUP transcription factor I, EAR3COUP-TF I, ERBAL3V-erbA-related protein 3, Nuclear receptor subfamily 2 group F member 1, nuclear receptor subfamily 2, group F, member 1, SVP44, TCFCOUP1, TFCOUP1NR2F2, transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3) | |
| NR2F1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title