COX-2 Rabbit anti-Human, Mouse, Rat, Clone: 2V7G8, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31622020UL

Catalog No. NB167532

Description

COX-2 Monoclonal antibody specifically detects COX-2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: COX-2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: 2V7G8
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: COX-2, COX2cyclooxygenase 2b, cyclooxygenase-2, EC 1.14.99, EC 1.14.99.1, GRIPGHS, hCox-2, PGG/HS, PGH synthase 2, PGHS-2, PHS II, PHS-2, prostaglandin G/H synthase 2, prostaglandin G/H synthase and cyclooxygenase, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase)
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX-2 (P35354). GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
• Quantity: 20 μg
• Research Discipline: Cancer, Cell Biology, Cellular Markers, Cytokine Research, Hypoxia, Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 5743
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG