Learn More
Description
Specifications
Specifications
| Antigen | COX-2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 2V7G8 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 50% glycerol, pH7.3 |
| Gene Alias | COX-2, COX2cyclooxygenase 2b, cyclooxygenase-2, EC 1.14.99, EC 1.14.99.1, GRIPGHS, hCox-2, PGG/HS, PGH synthase 2, PGHS-2, PHS II, PHS-2, prostaglandin G/H synthase 2, prostaglandin G/H synthase and cyclooxygenase, Prostaglandin H2 synthase 2, Prostaglandin-endoperoxide synthase 2, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX-2 (P35354). GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
